WWW.DISS.SELUK.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА
(Авторефераты, диссертации, методички, учебные программы, монографии)

 

На правах рукописи

Антонец Денис Викторович

Разработка методических подходов к рациональному дизайну

полиэпитопных Т-клеточных антигенов

03.01.03 – Молекулярная биология

03.0

АВТОРЕФЕРАТ

диссертации на соискание ученой степени

кандидата биологических наук

Кольцово - 2013 1

Работа выполнена в Федеральном бюджетном учреждении науки «Государственный научный центр вирусологии и биотехнологии «Вектор»

Научный Бажан Сергей Иванович, доктор биологических наук, руководитель заведующий теоретическим отделом ФБУН Государственный научный центр вирусологии и биотехнологии «Вектор»

Официальные Жуков Владимир Александрович доктор – оппоненты биологических наук, кандидат технических наук, заместитель генерального директора по ИТ ЗАО Вектор-Бест»

«Вектор Рыжиков Александр Борисович кандидат – биологических наук, заведующий отделом зоонозных инфекций и гриппа ФБУН Государственный научный центр вирусологии и биотехнологии «Вектор Вектор»

Ведущая ФГБУН Институт цитологии и генетики Сибирского организация отделения Российской академии наук

Защита состоится « 01 » марта 2013 г. в 1130 часов на заседании диссертационного совета Д 208.020.01 при ФБУН Государственный научный центр вирусологии и биотехнологии «Вектор» по адресу: 630559, р.п.

адресу Кольцово, Новосибирского района Новосибирской области, тел (383)336-74- тел.

С диссертацией можно ознакомиться в библиотеке ФБУН ГНЦ ВБ «Вектор»

знакомиться

Автореферат разослан « 18 » января 2013 г.

Ученый секретарь диссертационного совета д.б.н Г.П. Трошкова д.б.н.

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность проблемы. Т-клеточные эпитопы приобретают все большее значение в качестве инструментов для разработки новых средств иммунодиагностики и иммунотерапии, а также для проектирования искусственных полиэпитопных антигенов – вакцин против инфекционных и онкологических заболеваний (Berzofsky & Berkower, 1995; Woodberry et al., 1999; Bazhan et al., 2004; Tine et al., 2005; Iglesias et al., 2007; Cardinaud et al., 2009). Разработка компьютерных методов предсказания Т-клеточных эпитопов является одной из главнейших задач биоинформатики в области иммунологии, так как применение программ, предсказывающих Т-клеточные эпитопы, позволяет значительно сократить временные и материальные затраты по сравнению с использованием при поиске новых эпитопов и разработке полиэпитопных антигенов только экспериментальных подходов (Liu et al., 2011). Несмотря на то, что к настоящему времени создано большое количество различных программ для предсказания Т-клеточных эпитопов (Singh & Raghava, 2003; Nielsen et al., 2004; Wan et al., 2006; Kim et al., 2012), разработка новых методов остается по-прежнему актуальной задачей, так как ни один из ныне существующих методов не может быть признан единственно верным и превосходящим прочие, и поскольку использование консенсусного подхода, объединяющего возможности различных алгоритмов, в значительной степени превосходит по качеству предсказаний Т-клеточных эпитопов каждый из методов по отдельности (Wang et al., 2008; Lafuente & Reche, 2009).

Конструирование полиэпитопных Т-клеточных антигенов, содержащих множественные Т-клеточные эпитопы, является одним из наиболее многообещающих подходов к созданию новых эффективных и безопасных вакцин (Berzofsky & Berkower, 1995; Woodberry et al., 1999; Bazhan et al., 2004;

Tine et al., 2005; Iglesias et al., 2007; Cardinaud et al., 2009). Несмотря на то, что в первых работах, посвященных изучению ДНК-вакцин, кодирующих искусственные полиэпитопные антигены, была показана способность конструкций, составленных в результате простого объединения эпитопов, индуцировать цитотоксический Т-клеточный ответ на все эпитопы, включенные в их состав (Thomson et al., 1995), в дальнейшем было обнаружено, что иммуногенность пептидов в составе полиэпитопа в значительной степени зависит от фланкирующих аминокислотных остатков (Livingston et al., 2001).

Введение в состав полиэпитопного антигена спейсерных аминокислотных последовательностей, обеспечивающих образование сайтов протеасомного расщепления между эпитопами и оптимизирующих связывание пептидных фрагментов с TAP (транспортерами, ассоциированными с процессингом антигенов, транслоцирующими олигопептиды в эндоплазматический ретикулум), приводит к увеличению иммуногенности за счет повышения эффективности процессинга и презентации целевых эпитопов иммунной системе (Ishioka et al., 1999; Livingston et al., 2001; Cardinaud et al., 2009). Кроме того, существенное влияние на иммуногенность оказывают перестановки эпитопов в составе полиэпитопной конструкции (Livingston et al., 2001).

Однако, несмотря на большое количество работ, посвященных конструированию полиэпитопных антигенных конструкций и исследованию их иммуногенности и протективности, к настоящему моменту не было предложено ни одного алгоритма рационального конструирования полиэпитопных Т-клеточных антигенов.

Цели исследования. Разработка новых методов предсказания Т-клеточных эпитопов и алгоритмов рационального дизайна полиэпитопных Т-клеточных антигенов.

Задачи исследования:

1. Разработка статистических моделей, предсказывающих аффинность связывания олигопептидов с различными алломорфами молекул MHC.



2. Выбор оптимальной схемы параметризации пептидов в результате сравнения качества предсказаний, полученных моделями, использующими различные способы параметризации олигопептидов – записи аминокислотных последовательностей в виде разреженных векторов (факторизация аминокислот), либо в виде векторов физикохимических свойств аминокислотных остатков.

3. Подтверждение качества полученных предсказательных моделей в результате сравнительного тестирования с рядом других известных методов предсказания Т-клеточных эпитопов (SYFPEITHI, ProPred1, SVMHC, SVRMHC, NetMHC, SMMPMBEC и IEDB_recommended).

4. Формализация задачи рационального дизайна полиэпитопных антигенов и разработка алгоритма ее решения, выбирающего наилучшие спейсерные последовательности для каждой пары эпитопов и подбирающего оптимальное взаимное расположение эпитопов в составе полиэпитопа с целью увеличения эффективности презентации целевых эпитопов и минимизации количества нецелевых.

5. Создание на основе разработанных алгоритмов и методов программного обеспечения для предсказания Т-клеточных эпитопов и для проектирования полиэпитопных Т-клеточных антигенов.

6. Конструирование с помощью созданного программного обеспечения прототипа полиэпитопного антигена меланомы человека для верификации разработанных моделей, алгоритмов и программ.

Научная новизна и практическая значимость. В рамках данной работы были разработаны статистические регрессионные модели для предсказания аффинности связывания олигопептидов с 35 различными аллельными вариантами молекул HLA I класса. Полученные модели продемонстрировали высокое качество предсказаний. Впервые было проведено исследование, направленное на выявление скрытой размерности пространства, описывающего взаимное сходство иммунохимических свойств аминокислотных остатков.

Впервые была формализована задача рационального дизайна полиэпитопных Т-клеточных антигенов и разработан алгоритм ее решения.

На основе разработанных моделей и алгоритмов было создано программное обеспечение для предсказания Т-клеточных эпитопов (TEpredict) и рационального дизайна полиэпитопных Т-клеточных антигенов (PolyCTLDesigner). Был проведен дизайн полиэпитопного антигена, составленного из предсказанных CD8+ и CD4+ Т-клеточных эпитопов антигенов меланомы человека, и получена ДНК-вакцинная конструкция, несущая искусственный ген, кодирующий целевой полиэпитоп. Изучение созданной ДНК-вакцины в системе индукции Т-клеточного иммунного ответа ex vivo подтвердило иммуногенность полиэпитопной конструкции и перспективность выбранного направления исследований.

Разработанные в рамках исследования методы, алгоритмы и программное обеспечение могут быть использованы для проектирования полиэпитопных антигенов – новых кандидатных иммунотерапевтических и профилактических вакцин от онкологических и инфекционных заболеваний человека.

Положения, выносимые на защиту:

1. Разработанные статистические регрессионные модели предсказывают аффинность связывания нонамерных пептидов с 35 аллельными вариантами молекул MHC I класса человека.

2. Модели, использующие кодирование пептидов в виде векторов свойств составляющих их аминокислотных остатков, обеспечивают большую специфичность при соответствующей чувствительности предсказаний, по сравнению с моделями, кодирующими олигопептиды в виде разреженных 3. Разработанные модели по качеству предсказаний превосходят такие методы как SYFPEITHI, ProPred1, SVMHC и SVRMHC и не уступают лучшим современным методам предсказания Т-клеточных эпитопов NetMHC, SMMPMBEC и IEDB_recommended.

4. Разработанный алгоритм рационального дизайна полиэптопных Т-клеточных антигенов позволяет оптимизировать структуру полиэпитопной конструкции с учетом современных знаний о путях процессинга белковых антигенов и их презентации иммунной системе.

5. Полиэпитопная конструкция MEL-TCI-A0201, спроектированная с помощью разработанных моделей и алгоритмов, содержащая множественные CD4+ и CD8+ Т-клеточные эпитопы основных антигенов меланомы человека, обладает способностью индуцировать специфический Т-клеточный иммунный ответ.

Вклад автора. Создание статистических регрессионных моделей для предсказания аффинности связывания олигопептидов с 35 аллельными вариантами молекул HLA I класса, создание программного обеспечения для предсказания Т-клеточных эпитопов и разработка алгоритма и программного обеспечения для дизайна полиэпитопных Т-клеточных антигенов, проектирование Т-клеточных полиэпитопных антигенов было осуществлено автором лично. Получение ДНК-вакцин, кодирующих целевые полиэпитопные антигены, было осуществлено сотрудниками отдела биоинженерии ФБУН ГНЦ ВБ «Вектор». Исследование иммуногенности созданных полиэпитопных антигенов проведено сотрудниками лаборатории молекулярной иммунологии НИИ Клинической иммунологии СО РАМН без участия автора.

Структура и объем работы. Диссертация изложена на 144 страницах машинописного текста и состоит из введения, обзора литературы, главы «Материалы и методы», главы «Результаты и обсуждение», заключения, выводов и списка литературы. Библиография включает 274 работы. Работа иллюстрирована 24 рисунками и включает 6 таблиц.

Апробация результатов диссертации и публикации. По материалам диссертационной работы опубликовано 5 статьей в реферируемых научных журналах, входящих в список ВАК, подана заявка на патент РФ (регистрационный № 2012136088 от 21.08.2012 г.). Результаты работы были представлены на 17 международных и российских конференциях.

Программное обеспечение, созданное в рамках данной работы, опубликовано на сайте проекта (http://tepredict.sourceforge.net) под свободной лицензией Creative Commons Attribution Non-Commercial License V2.0 (CC BYNC 2.0). С момента создания было загружено более 200 раз пользователями из 30 стран.

МАТЕРИАЛЫ И МЕТОДЫ ИССЛЕДОВАНИЯ

Формулировка моделей, предсказывающих аффинность связывания олигопептидов с молекулами MHC. Модели, предсказывающие аффинность связывания олигопептидов с молекулами MHC, как правило, основаны на предположении о том, что энергия связывания пептида с молекулой MHC может быть представлена как сумма вкладов каждого из аминокислотных остатков (а.к.о.) пептида (Parker et al., 1994). Для построения предсказательных моделей была использована информация, извлеченная из IEDB (Immune Epitope Database) (Peters et al., 2005). В качестве количественной меры аффинности связывания олигопептида с молекулой MHC для построения моделей использовалось значение pIC50 – отрицательного десятичного логарифма значения IC50 (50 % ингибирующей концентрации), извлеченного из IEDB. При построении моделей использовались данные только о нонамерных пептидах, поскольку показано, что пептиды, взаимодействующие с молекулами MHC I класса, в основном имеют длину в 9 а.к.о. (Rudolph et al., 2006; Lundegaard et al., 2010).

Модели, предполагающие независимость вкладов индивидуальных а.к.о., могут быть представлены в виде формулы (1), где Pi является вектором свойств, кодирующим аминокислоту в позиции i, а i – вектор коэффициентов уравнения регрессии.

Кроме того, были созданы модели, учитывающие взаимное влияние соседних аминокислот, представленные формулой (2), где Pi является вектором свойств, кодирующим аминокислоту в позиции i, а i – вектор коэффициентов независимых вкладов каждого из а.к.о. олигопептида; i – вектор коэффициентов для пар соседних а.к.о., а i – для троек соседних а.к.о.

Для построения предсказательных моделей использовались метод частных наименьших квадратов (PLS – partial least squares) и его недавняя модификация – SPLS (sparse partial least squares).

Параметризация аминокислот и олигопептидов. Существенное влияние на точность моделей оказывает выбор схемы параметризации (Lui et al., 2006;

Kim et al., 2009). Для параметризации пептидов в данной работе были использованы следующие способы:

1) а.к.о. пептида представляются в виде взаимно ортогональных факторов – каждый а.к.о. кодируется в виде разреженного вектора (sparse encoding);

2) а.к.о. записываются в виде векторов свойств, полученных из шкалы свойств а.к.о., созданной Кидера и соавторами (Kidera et al., 1985);

3) кодирование в виде векторов свойств, полученных из шкалы свойств а.к.о., предложенной Лю и соавторами (Liu et al., 2006);

4) кодирование а.к.о. в виде соответствующих строк матрицы THREADER_NORM (Dosztanyi & Torda, 2001), приведенной к симметричному виду и нормированной согласно Ву и коллегам (Wu et al., 2006);

5) кодирование а.к.о. пептида в виде соответствующих строк матрицы PMBEC (Kim et al., 2009).

С помощью метода независимых компонент (ICA – independent component analysis), реализованного в библиотеке программ PearsonICA (Karvanen & Koivunen, 2002) для языка и среды статистического анализа и моделирования R (http://r-project.org), а также с помощью метода Саммона (Sammon, 1969) и метода изометрического шкалирования (Chen et al., 2008), реализованных в библиотеке MASS (Venables & Ripley, 2002) для R, на основе матрицы PMBEC был создан ряд шкал меньшей размерности (от 2 до 19 координат).

Метод частных наименьших квадратов (PLS). Метод частных наименьших квадратов (Partial Least Squares) был разработан в 1966 году для решения задач эконометрики (Wold, 1966), но стал популярным уже как метод хемометрики (Wold et al., 1983), а затем начал широко использоваться в самых различных областях, в том числе в биоинформатике (Doytchinova et al., 2004a;

Bremel & Homan, 2010). Столь широкое использование метода PLS обусловлено тем, что он способен эффективно работать с данными со значительным уровнем шума и коллинеарности, а также в случаях, когда количество регрессоров превышает количество наблюдений, когда обычные методы множественной регрессии практически бессильны. Подробное описание метода представлено в литературных источниках (Эсбенсен, 2003;

Mevik & Wehrens, 2007). В данной работе был использован метод, реализованный в библиотеке компьютерных программ pls (Mevik & Wehrens, 2007) для R.

Метод SPLS (Sparse Partial Least Squares). Несмотря на то, что в основе метода PLS лежит снижение размерности, он не предназначен для отбора признаков, и, кроме того, поскольку скрытые компоненты, найденные с помощью PLS, представляют собой линейные комбинации всех переменных, интерпретация полученной модели может вызвать значительные затруднения, особенно в случае высокой размерности данных. Недавно было показано, что при использовании метода PLS наличие в данных нерелевантных предикторов оказывает существенное влияние на результат, и был предложен новый метод, названный SPLS (sparse partial least squares), способный выбрать оптимальное количество релевантных предикторов и число скрытых компонент (Chun & Keles, 2010; Chun & Keles, 2010a). В данной работе был использован метод SPLS, реализованный в библиотеке программ spls (Chun & Keles, 2010) для R.

Использованное программное обеспечение. Все программы, созданные в рамках данной работы, были написаны на языке программирования Python.

Операции с массивами и матрицами реализованы с использованием библиотеки SciPy (Jones et al., 2001). Для чтения аминокислотных последовательностей из файлов формата Fasta или GenBank использованы функции, реализованные в библиотеке BioPython (Cock et al., 2009). Построение статистических моделей проводилось с использованием языка и среды статистического моделирования R (версии 2.4.1-2.15.1) с помощью среды разработки RStudio. Для анализа способов параметризации аминокислот и для снижения размерности описательного пространства были использованы метод Саммона и метод изометрического шкалирования, реализованные в библиотеке MASS (Venables & Ripley, 2002) для R, а также метод независимых компонент, реализованный в бибилиотеке PearsonICA (Karvanen & Koivunen, 2002) для R. Для построения предсказательных моделей были использованы специализированные библиотеки для R: pls (Mevik & Wehrens, 2007) и spls (Chun & Keles, 2010). Для оценки качества предсказаний использовалась библиотека ROCR (Sing et al., 2005) для R. При создании программы PolyCTLDesigner для выбора оптимальной последовательности цитотоксических эпитопов был использован генетический алгоритм решения задачи коммивояжера, реализованный в библиотеке программ PyEvolve для Python. Все использованное в данной работе программное обеспечение, а также программы, созданные автором данного исследования, распространяются под различными свободными лицензиями.

Дополнительные модели, использованные в программах TEpredict и PolyCTLDesigner. Кроме оригинальных моделей в программы TEpredict и PolyCTLDesigner были включены:

• Модель для предсказания протеасомного процессинга белковых антигенов (Toes et al., 2001; Singh & Raghava, 2003).

• Модель для предсказания иммунопротеасомного процессинга белковых антигенов (Toes et al., 2001; Singh & Raghava, 2003).

• Модели для предсказания CD8+ Т-клеточных эпитопов, разработанные Сингхом и Рагхавой для ProPred1 (Singh & Raghava, 2003).

• Модели для предсказания CD4+ Т-клеточных эпитопов, разработанные Сингхом и Рагхавой для ProPred (Singh & Raghava, 2001). В основе этих моделей лежат виртуальные матрицы, описывающие специфичность сайтов связывания пептидов различных алломорф HLA-DRB, реализованные в программе TEPITOPE (Sturniolo et al., 1999).

• Модели для предсказания CD8+ Т-клеточных эпитопов, разработанные Бхасином и Рагхавой для nHLAPred (Bhasin & Raghava, 2007).

• Модель для предсказания аффинности связывания олигопептидов с TAP, разработанная Петерсом и коллегами (Peters et al., 2003).

• Модель для предсказания аффинности связывания олигопептидов с TAP, разработанная Дойчиновой и коллегами (Doytchinova et al., 2004).

РЕЗУЛЬТАТЫ И ОБСУЖДЕНИЕ

Создание статистических моделей для предсказания аффинности связывания олигопептидов с различными алломорфами молекул HLA I класса. Для построения моделей был выбран метод частных наименьших квадратов (PLS). Из базы данных Immune Epitope Database (IEDB) (Peters et al., 2005) были собраны тренировочные наборы пептидов, для которых были определены количественные характеристики связывания с любым из аллельных вариантов молекул HLA I класса (HLA-A*0101, A*0201, A*0202, A*0203, A*0206, A*0301, A*1101, A*2301, A*2402, A*2403, A*2601, A*2902, A*3001, A*3002, A*3101, A*3301, A*6801, A*6802, A*6901, B*0702, B*0801, B*1501, B*1801, B*2705, B*3501, B*4001, B*4002, B*4402, B*4403, B*4501, B*5101, B*5301, B*5401, B*5701, B*5801) – значения IC50, концентрации полумаксимального ингибирования. IC50 определяется в результате исследования конкурентного ингибирования связывания с молекулой MHC меченного референсного пептида различными концентрациями исследуемого пептида (Sette et al., 1994; van der Burg et al., 1996). Пептиды, для которых значение IC50 превышает 500 нМ (pIC50 < 6.3), что соответствует низкой аффинности связывания с молекулой MHC, практически не обладают способностью индуцировать цитотоксический Т-клеточный ответ (Sette et al., 1994). Нонапептиды, для которых аффинность связывания была измерена недостаточно точно или была охарактеризована лишь качественно, вошли в тестовые наборы. При обучении моделей использовался метод полной кроссвалидации (LOO – leave one out).

Для параметризации пептидов применялось кодирование аминокислот в виде векторов свойств, поскольку такой подход позволяет учесть взаимное сходство а.к.о., как это было отмечено в литературе (Nielsen et al., 2003; Wan et al., 2006; Kim et al., 2009). Было использовано несколько схем кодирования:

запись аминокислот в виде векторов с 10 координатами – значениями, взятыми из шкал, разработанных Кидера и др. (K10); запись в виде векторов с координатами, соответствующими значениям, взятым из шкал, разработанных Лю и др. (L11); и запись в виде соответствующих строк матрицы THREADER_NORM (THDR).

Полученные модели были протестированы на данных, не включенных в тренировочные выборки. Для каждого из аллельных вариантов МНС были выбраны наилучшие модели. В двух из них для параметризации аминокислот используется шкала K10; в восьми – шкала L11 и в 25 моделях используется шкала THDR. Большинство моделей продемонстрировали хорошее качество предсказания – значение площади под графиком ошибок (AUC – Area Under the Curve), характеризующим специфичность и чувствительность предсказания, было не меньше 0.76, у 20 из них значение AUC было больше 0.80 (HLAA*0101, A*0201, A*0206, A*0301, A*1101, A*2402, A*2403, A*3001, A*3101, A*3301, A*6801, A*6802, A*6901, B*0702, B*0801, B*1501, B*2705, B*4402, B*5701, B*5801), для 8 моделей полученное значение AUC превысило 0. (высокое качество предсказаний). При пороговом значении pIC50, равном 6.3, для всех выбранных моделей специфичность (Спец) предсказаний находилась в диапазоне от 0.25 до 1.0 (медианное значение Спец6.3 было равно 0.70), чувствительность (Чув) – в диапазоне от 0.33 до 1.0 (медианное значение Чув6.3 было 0.81), точность (Точ) – 0.35-0.96 (медианное значение Точ6.3 равно 0.76). При pIC50, равном 7.3, специфичность находилась в пределах от 0.74 до 1.0 (медианное значение было равно 0.95), чувствительность – от 0.03 до 0. (медианное значение 0.35), точность – 0.48-0.98 (медианное значение 0.72) (Рис. 1).

Рис. 1. Результаты тестирования новых PLS-моделей, предсказывающих аффинность связывания олигопептидов с 35 различными аллельными вариантами молекул HLA I класса.

AUC – распределение значений площади под кривой ошибок, характеризующей специфичность и чувствительность предсказания. Обозначения Спец6.3, Чув6.3 и Точ6. соответствуют значениям специфичности, чувствительности и точности (accuracy) предсказаний при пороговом значении pIC50 = 6.3.

Для четырех аллельных вариантов молекул HLA I класса (А*0101, А*0201, А*0301 и B*0702) проводилось сравнительное тестирование качества предсказаний, полученных с помощью созданных моделей и программ SVRMHC (Wan et al., 2006), SVMHC (Donnes & Elofsson, 2002), ProPred1 (Singh & Raghava, 2003) и SYFPEITHI (Rammensee et al., 1999). Для каждого из аллелей было сформировано по две тестовые выборки: одна из данных, собранных из базы MHCBN (Bhasin et al., 2003), и другая из данных IEDB. В тестовые выборки были включены как нонамерные пептиды, так и пептиды большей длины. В последнем случае пептид считался связывающимся с аллельным вариантом молекулы MHC, если в его составе предсказывался способный к связыванию нонапептид. ROC-кривые (кривые ошибки, характеризующие специфичность и чувствительность предсказания) приведены на Рисунке 2. Результаты сравнительного тестирования показали, что разработанные модели превосходят все другие использованные методы.

Рис. 2. Сравнение качества предсказаний программ TEpredict (оригинальные модели), ProPred1, SVMHC, SVRMHC и SYFPEITHI для HLA-A*0101 (а), HLA-A*0201 (б), HLAA*0301 (в) и HLA-B*0702 (г) с использованием тестовых наборов из базы данных MHCBN.

Приведены графики ошибок (ROC) – графики чувствительности (ось абсцисс) и специфичности (ось ординат). Для каждого из методов указано значение AUC. SVMHCm обозначает, что для предсказания использовались модели SVMHC, для обучения которых использовались данные MHCBN; SVMHCs – что данные модели были получены с использованием базы данных SYFPEITHI.

Создание программы для предсказания Т-клеточных эпитопов. На основе разработанных моделей была создана программа TEpredict. Для ее написания был выбран высокоуровневый объектно-ориентированный интерпретируемый язык программирования Python. TEpredict – кроссплатформенное программное обеспечение. Кроме того, был создан дистрибутив программы для ОС Windows, содержащий исполняемые файлы и не требующий установки Python на компьютере пользователя. TEpredict позволяет проводить предсказание CD8+ Т-клеточных эпитопов с использованием как оригинальных моделей, так и моделей программ ProPred1 (Singh & Raghava, 2003) и nHLAPred (Bhasin & Raghava, 2007); предсказывать CD4+ Т-клеточные эпитопы с помощью моделей ProPred (Singh & Raghava, 2001); предсказывать протеасомный и иммунопротеасомный процессинг антигенов, используя модели, разработанные Тоузом и коллегами (Toes et al., 2001), и аффинность связывания олигопептидов с TAP, используя известные модели (Peters et al., 2003; Doytchinova et al., 2004). Программа находится в свободном доступе на сайте проекта http://tepredict.sourceforge.net.

Обновление моделей, используемых программой TEpredict для предсказания Т-клеточных эпитопов. Выбор схемы параметризации олигопептидов оказывает существенное влияние на точность моделей, особенно когда построение модели выполняется на основе небольшого тренировочного набора данных, в то время как теоретически возможное количество различных нонапептидов равно 5.12 1011 (209). Таким образом, использование адекватной меры взаимного сходства а.к.о. позволяет создать более точные модели, чем кодирование а.к.о. в виде разреженных векторов (Wan et al., 2006; Kim et al., 2009). В данной работе для параметризации пептидов, помимо кодирования а.к.о. в виде взаимно ортогональных факторов (sparse encoding), была использована недавно разработанная матрица сходства аминокислотных остатков PMBEC (Kim et al., 2009). Авторами матрицы PMBEC было убедительно показано превосходство моделей, построенных с ее помощью, над моделями, построенных с помощью записи пептидов в виде разреженных векторов или с помощью матрицы BLOSUM62. В отличие от матрицы BLOSUM62, согласно PMBEC аминокислотные остатки, имеющие противоположные заряды, существенно отличаются, что гораздо более обосновано с физической точки зрения при анализе взаимодействия пептидов с молекулой MHC (Kim et al., 2009). Кроме того, были созданы модели, использующие для параметризации пептидов матрицу THDR, показавшую хорошие результаты ранее.

Матрица PMBEC является вырожденной – существует значительная корреляция между профилями различных аминокислотных остатков. Согласно литературным данным (Kidera et al., 1985; Wan et al., 2006; Launay et al., 2007), скрытая размерность пространства, описывающего аминокислотные остатки, должна быть ниже 20 и согласно указанным источникам должна равняться 10, 11 и 4, соответственно. С помощью метода главных компонент и факторного анализа матрицы PMBEC было обнаружено, что оптимальным для описания а.к.о. является использование от 4 до 8 компонент. Даже проекция шкалы PMBEC в двумерное и трехмерное пространство приводит к отчетливой кластеризации аминокислот по их физико-химическим свойствам (Рис. 3).

аминокислотные остатки, было преобразовано в ряд пространств меньшей размерности (от 2 до 19 измерений). Шкалирование проводилось с использованием метода независимых компонент (ICA) (Karvanen & Koivunen, 2002) либо с использованием изометрического многомерного шкалирования (isoMDS) (Chen et al., 2008) и метода Саммона (Sammon, 1969), реализованных в библиотеке MASS для R. Все полученные шкалы (наряду с оригинальной матрицей PMBEC и кодированием пептидов в виде разреженных векторов) были использованы для построения моделей, предсказывающих аффинность связывания нонапептидов с 35 различными аллельными вариантами молекул HLA I класса. Шкалы полученные с помощью изометрического шкалирования и метода Саммона в дальнейшей работе не использовались так как PLSзовались, модели, построенные с их использованием по качеству предсказаний уступают моделям, построенным с помощью шкал той же размерности, полученных методом независимых компонент (Рис. 4).

Рис. 3. А и Б – отображения аминокислотных остатков, записанных в виде строк матрицы PMBEC, в двумерное и трехмерное пространство, соответственно. Снижение размерности матрицы PMBEC было выполнено с помощью метода независимых компонент ICA (Karvanen & Koivunen, 2002).

Comparison of 10D scales AUC values 1. 0. 0. 0. 0. Для создания новых статистических моделей были использованы методы PLS и SPLS. Были использованы готовые тестовые и тренировочные наборы пептидов (Kim et al., 2009) Модели строились с использованием 10-кратной кросс-валидации. Для каждого из 35 аллельных вариантов HLA было построено по 5 моделей и итоговым результатом предсказания является среднее арифметическое значений pIC50.

На основе анализа построенных моделей для дальнейшей работы была выбрана 11-мерная шкала ( мерная (ica11s), так как модели, использующие ее, содержат меньшее количество скрытых переменных, чем построенные с использованием шкал ica7s-ica10s, ica12s, ica коэффициента корреляции Пирсона PLS модели, построенные с использованием ica11s, превосходили модели, построенные с использованием шкал ica3s-ica10s, и не уступали моделям, построенным с использованием шкал ica12s-ica14s, а также PMBEC и sparse (Рис. 5).

Рис. 5. Распределения значений AUC (A) и коэффициентов корреляции Пирсона (Б), полученных в результате тестирования моделей. Модели были построены с помощью метода PLS, для параметризации олигопептидов использовались шкалы ica3s, ica4s, ica5s, ica6s, ica7s, ica8s, ica9s, ica10s, ica11s, ica12s, ica13s, ica14s, PMBEC или sparse.

Для PLS моделей, построенных с помощью шкалы ica11s, среднее и медианное значения AUC, полученные в результате тестирования, составили 0.9054 и 0.9163, соответственно; для моделей, построенных с использованием PMBEC, эти значения составили 0.9142 и 0.9263, а с использованием sparse – 0.9102 и 0.9197, соответственно. Модели, построенные с использованием PMBEC, достоверно превзошли по значениям AUC модели, построенные на основе шкалы sparse (p = 2.01 10-6), значимость отличий определяли с помощью парного теста Уилкоксона. Однако модели, использующие PMBEC, обладали меньшей точностью в отношении аллелей с небольшими тренировочными наборами (< 500 пептидов), чем модели, построенные на основе шкал, полученных с помощью ICA.

Далее проводилось построение моделей с помощью SPLS с использованием шкалы ica11s, PMBEC, THDR, и шкалы ica5. Результаты анализа качества предсказаний полученных моделей показали, что модели, построенные с использованием шкалы ica5, существенно уступают моделям, использующим другие шкалы. Интересно отметить, что качество моделей, построенных с помощью PMBEC, THDR и ica11s практически не отличается ни по значениям AUC, ни по значениям коэффициента корреляции Пирсона (Рис. 6). Для моделей, построенных с помощью шкал ica11s, PMBEC и THDR, медианные значения AUC составили 0.8975, 0.9017 и 0.9039, а средние – 0.8811, 0.8767 и 0.8828, соответственно. Однако модели, построенные с помощью ica11s, отличаются меньшей сложностью – они содержат меньшее количество скрытых компонент, а значит, в меньшей степени подвержены переобучению.

Кроме того, для аллельных вариантов молекул HLA I с небольшими тренировочными наборами пептидов (менее 500) модели, построенные с

CC CC CC AUC AUC AUC

наборе (от 47 для HLA-B*5701 до 2471 для HLA-A*0201).

THDR или ica11s. Насыщенность окраски показывает число пептидов в тренировочном олигопептидов с 35 аллельными вариантами молекул HLA I класса. Модели были построено по пять моделей, использующих для параметризации пептидов шкалы PMBEC, построены с помощью метода SPLS. Для каждого из указанных аллелей HLA было Рис. 6. Распределения значений AUC (А) и коэффициента корреляции Пирсона (CC) (Б), полученных в результате тестирования предсказаний аффинности связывания помощью ica11s, продемонстрировали достоверно более высокое качество предсказаний (значение AUC), чем модели, построенные с помощью PMBEC (p = 0.03). Затем проводилось повторное обучение SPLS-моделей, использующих шкалу ica11s. При этом из тренировочных наборов исключалось до 10 пептидов, определенных как вероятные выбросы с помощью функции pcout из пакета mvoutlier (Filzmoser et al., 2008) для R. После этого качество моделей заметно выросло и достоверно превзошло качество моделей, построенных с помощью PMBEC (p = 2.7 10-5) и THDR (p = 0.002). После повторного обучения моделей, использующих ica11s, медианное значение AUC составило 0.9161, среднее – 0.9056. Значение AUC для 75 % моделей превысило 0.88. Значения коэффициентов корреляции Пирсона между предсказанными и измеренными значениями pIC50 находились в пределах от 0.40 до 0.89; медиана и среднее составили 0.73 и 0.70, соответственно. Несмотря на то, что по значениям AUC SLPS модели практически не отличались от PLS моделей (p = 0.1), они достоверно превзошли PLS модели по значениям коэффициентов корреляции Пирсона (p = 5.84 10-8).

Было проведено сравнение качества предсказаний, полученных с помощью новых моделей TEpredict, использующих шкалы PMBEC и ica11s, с предсказаниями, полученными с использованием методов, реализованных на веб-портале IEDB: ann (NetMHC) (Nielsen et al., 2004), SMMPMBEC (Kim et al., 2009) и IEDB_recommended (Kim et al., 2012). Для тестирования были выбраны наборы пептидов для 7 аллельных вариантов молекул HLA I класса (A*0101, A*0201, A*0301, A*1101, A*2402, B*0801 и B*1501), использованные в недавнем соревновании методов предсказания Т-клеточных эпитопов (Zhang et al., 2011).

Наилучшие результаты (по значению AUC) были получены с использованием метода IEDB_recommended (Рис. 7), но этот метод является полуколичественным, и среди сравниваемых методов результаты его предсказаний в наименьшей степени коррелируют с экспериментально определенными значениями аффинности связывания пептидов с молекулами MHC. По медианным значениям AUC после IEDB_recommended (0.9461) идут ica11s (0.9121) и PMBEC (0.9174), затем следуют ann (0.9081) и smmpmbec (0.9072). Медианные значения коэффициентов корреляции Пирсона для IEDB_recommended, ica11s, PMBEC, ann и smmpmbec составили 0.51, 0.65, 0.64, 0.75 и 0.74, соответственно. При сравнении результатов предсказаний по HLAA*0201, A*1101 и A*2402 оригинальные модели TEpredict превзошли (по AUC) smmpmbec и ann. Для аллелей HLA-A*0101, A*0301, B*0702 и B*1501 качество предсказаний, полученных с использованием разных методов, отличалось незначительно. Новые модели, построенные с использованием SPLS и шкал PMBEC и ica11s, показали хорошее качество предсказаний, сопоставимое с качеством лучших современных методов предсказания Т-клеточных эпитопов.

Разработка программного обеспечения для рационального дизайна полиэпитопных Т-клеточных антигенов.

многообещающих подходов к созданию новых эффективных и безопасных вакцин является конструирование искусственных полиэпитопных антигенов. В настоящее время активно ведутся работы по созданию и изучению искусственных вакцинных конструкций, содержащих множественные CTLэпитопы вирусных и раковых антигенов (Woodberry et al., 1999; Smith et al., 2001; Iglesias et al., 2007; Cardinaud et al., 2009; Gao et al., 2009; Bei & Scardino, 2010; Rosa et al., 2011). Показано, что перестановки эпитопов в рамках полиэпитопной конструкции влияют на иммуногенность эпитопов (Livingston et al., 2001), и что использование спейсерных последовательностей, создающих сайты протеасомного расщепления между эпитопами и оптимизирующих взаимодействие пептидов с TAP, в значительной степени увеличивает способность полиэпитопов индуцировать цитотоксический Т-клеточный иммунный ответ (Livingston et al., 2001; Cardinaud et al., 2009). Но, несмотря на большое количество работ, посвященных конструированию и исследованию полиэпитопных антигенных конструкций, к настоящему моменту не предложено ни одного алгоритма рационального конструирования полиэпитопных Т-клеточных антигенов. Целью данной работы явилась разработка программного обеспечения PolyCTLDesigner, предназначенного для дизайна полиэпитопных Т-клеточных антигенов, обеспечивающих высокий уровень ответа CD8+ Т-лимфоцитов на все включенные в их состав CTLэпитопы за счет оптимизации спейсерных последовательностей между эпитопами и оптимизации порядка расположения эпитопов в конструкции.

PolyCTLDesigner интегрирован с программой TEpredict, используемой для предсказания Т-клеточных эпитопов. PolyCTLDesigner позволяет пользователю выбрать минимальный набор эпитопов с известной или предсказанной специфичностью к разным аллельным вариантам молекул MHC I класса, охватывающий выбранный репертуар аллелей HLA с заданным уровнем избыточности. Для выбранного набора эпитопов PolyCTLDesigner проводит предсказание аффинности связывания с TAP с помощью модели, разработанной Петерсом и коллегами (Peters et al., 2003). После анализа аффинности связывания пептидов с TAP PolyCTLDesigner проводит анализ всех возможных паросочетаний выбранных пептидов и для каждой пары последовательность, обеспечивающую расщепление эпитопов с высвобождением C-конца первого из пары пептидов. Для предсказания протеасомного и иммунопротеасомного расщепления PolyCTLDesigner использует модели, разработанные Тоузом и коллегами (Toes et al., 2001). Для оптимизации протеасомного расщепления, обеспечивающего высвобождение C-конца пептида «1», N-конец пептида «2» при необходимости может быть продлен спейсерной последовательностью до шести аминокислотных остатков в длину. При этом из предложенной спейсерной последовательности (например, из оптимального, согласно выбранной модели, спейсера ADLVKV) с помощью PolyCTLDesigner последовательно тестируются спейсеры A, AD, ADL, ADLV, ADLVK, ADLVKV. PolyCTLDesigner может использовать и вырожденные мотивы, например [ARSP][DLIT][LGA][VKA], тогда программа генерирует и проверяет все возможные спейсерные последовательности.

При анализе паросочетаний эпитопов создается ориентированный граф, в котором вершины соответствуют эпитопам, а ребра – допустимым паросочетаниям. Для каждого ребра определяется оптимальная последовательность спейсера и вес, вычисляемый ранжирующей функцией согласно формуле (3), где W – вычисляемый вес ребра, который зависит от пептидов pep1 и pep2 и спейсерной последовательности ss (spacer sequence);

rankHLA обозначает ранг наиболее эффективно связывающегося с данным аллелем HLA нецелевого эпитопа; freqHLA – генотипическую частоту встречаемости аллеля HLA в целевой популяции; len(ss) – длина спейсера ss;

rankpr – предсказанный ранг сайта протеасомного расщепления, а rankimpr – сайта иммунопротеасомного расщепления; rankHLA с чертой сверху означает среднее значение параметра; Neps – количество предсказанных нецелевых эпитопов; NHLA – количество аллелей HLA, рестриктирующих ответ на нецелевые эпитопы.

4,,,,,,, + 0.05 -.&/ + 0.05 - + 0.25 &' + 0.25 ()&' В созданном ориентированном графе создаются недостающие ребра, соответствующие недопустимым вариантам паросочетаний пептидов, и им присваиваются слишком большие веса. Оптимальная последовательность полиэпитопного антигена находится как полный простой путь в построенном графе, обладающий наименьшей длиной (весом). Для решения этой задачи PolyCTLDesigner использует либо эвристический подход – метод ближайшего соседа, либо генетический алгоритм решения задачи коммивояжера, реализованный в библиотеке PyEvolve. Алгоритм PolyCTLDesigner представлен на Рис. 8.

Рис. 8. Алгоритм работы программы PolyCTLDesigner. I – предсказание аффинности связывания пептидов с TAP и добавление N-концевых фланкирующих а.к.о.; II – подбор оптимальных спейсерных последовательностей для каждой пары пептидов и создание направленного взвешенного графа, в котором вершины представляют целевые эпитопы, а ребра – допустимые варианты их объединения; III – конструирование последовательности полиэпитопного иммуногена (искомая последовательность определяется как наиболее длинный простой путь в созданном графе, обладающий наименьшим весом Кроме того, PolyCTLDesigner позволяет конструировать и последовательность полиэпитопного фрагмента содержащего Т-хелперные (Th) эпитопы. В предложенных антигенах программа выбирает пептидные фрагменты длиной 20-40 а.к.о., содержащие наибольшее количество перекрывающихся Т Т-хелперных эпитопов, рестриктированных наиболее широким репертуаром алломорф HLA II класса. К каждому из выбранных фрагментов из исходной последовательности антигена добавляется по 5 C- и N-концевых фланкирующих аминокислотных остатков, поскольку они могут играть важную роль в связывании с Т-клеточными рецепторами CD4+ Т-лимфоцитов (Lafuente & Reche 2009; Wang et al., 2008; Liao & Arthur 2011;

Rudolph et al., 2006) Фрагменты, содержащие Т-хелперные эпитопы, объединяются с использованием мотива [KR][KR], являющегося сайтом расщепления для ряда лизосомных катепсинов, участвующих в процессинге антигенов. Показано, что использование такого мотива увеличивает иммуногенность Т-клеточных эпитопов (Schneider et al., 2000; Zhu et al., 2005). Разработанное программное обеспечение доступно на сайте проекта http://tepredict.sourceforge.net/PolyCTLDesigner.html.

Проектирование полиэпитопных меланомных антигенов Несмотря на то, что на долю меланомы приходится достаточно небольшое количество случаев, примерно 3-9 % от всех случаев рака кожи являющегося одним из самых распространенных онкологических заболеваний, меланома привлекает значительное внимание исследователей, поскольку отличается чрезвычайно быстрым развитием и метастазированием, наиболее трудно поддается лечению и является наиболее агрессивным и опасным видом рака кожи.

Высокая иммуногенность меланомных опухолей позволяет предположить возможность создания эффективной терапевтической меланомной вакцины или разработки эффективной иммунотерапевтической стратегии, использующей последние достижения молекулярной иммунологии и клеточных технологий (Halama et al., 2010). Ряд меланомных антигенов, такие как Melan-A/MART-1, gp100, тирозиназа, MAGE-3 и NY-ESO-1, были использованы для разработки кандидатных вакцин (Halama et al., 2010;

Pandolfi et al., 2008).

Для апробации разработанного программного обеспечения было решено исследовать иммуногенность полиэпитопных антигенных конструкций, спроектированных с помощью TEpredict и PolyCTLDesigner, в модели индукции Т-клеточного иммунного ответа ex vivo, аналогично экспериментам, описанным в литературных источниках (Bonehill et al., 2004;

Bonini et al., 2001; Su et al., 2002). Для дизайна полиэпитопных конструкций было выбрано шесть меланомных антигенов: NY-ESO-1 (P78358), MART- (Q16655), MAGE-A1 (P43355), MAGE-A11 (P43364), MAGE-A3 (P43357) и MAGE-C1 (O60732).

С помощью разработанного программного обеспечения было проведено проектирование последовательностей двух искусственных Т-клеточных иммуногенов MEL-TCI (MELanoma T-Cell Immunogen) и MELTCI-A0201. Универсальный иммуноген (MEL-TCI) содержит множественные Т-клеточные эпитопы (как CD4+ Th, так и CD8+ CTL) опухолевых антигенов меланомы, рестриктированные 12 наиболее распространенными аллельными вариантами молекул HLA I класса (HLA-A*0101, A*0201, A*0301, A*1101, A*2402, A*6801, B*0702, B*0801, B*3501, B*1801, B*4402, B*2705), тогда как аллелеспецифический иммуноген (MEL-TCI-A0201) содержит эпитопы, рестриктированные только HLA-A*0201.

При проектировании конструкции MEL-TCI для включения в состав полиэпитопов отбирались только те пептиды, для которых предсказанное значение pIC50 было не ниже 6.8 при связывании хотя бы с одним из выбранных аллелей HLA. Кроме того, предсказывался протеасомный и иммунопротеасомный процессинг антигенов, а также аффинность связывания пептидов с транспортерами, ассоциированными с процессингом антигенов. С помощью программы PolyCTLDesigner из каждого из антигенов было выбрано 74 потенциальных Т-клеточных эпитопа, покрывающих выбранный репертуар аллелей HLA с двукратной избыточностью.

При проектировании аллелеспецифического варианта полиэпитопного антигена MEL-TCI-A0201, с помощью программы TEpredict в выбранных антигенах были предсказаны CTL-эпитопы, рестриктированные HLAA*0201. Также как и в случае предсказания эпитопов для универсальной конструкции, в качестве порогового значения было выбрано значение pIC50 = 6.8; предсказывался протеасомный и иммунопротеасомный процессинг антигенов, а также аффинность связывания пептидов с транспортерами, ассоциированными с процессингом антигенов. В результате было отобрано 19 пептидов.

Далее проводился дизайн поли-CTL-эпитопных фрагментов MEL-TCI и MEL-TCI-A0201. Использовался вырожденный спейсерный аминокислотный мотив [ARSP][DLIT][LGA][VKA]. В обоих случаях при выборе наилучших спейсеров для каждой пары эпитопов проводилась минимизация количества нецелевых эпитопов, образующихся при стыковке пептидов, рестриктированных 12 наиболее распространенными аллелельными вариантами молекул HLA I класса.

Для наиболее эффективной индукции Т-клеточного иммунного ответа необходимо стимулировать ответ не только CD8+, но и CD4+ Т-лимфоцитов, поэтому следующей задачей было конструирование поли-Th-эпитопного фрагмента. Для этого с помощью TEpredict проводилось предсказание в составе выбранных раковых антигенов Th эпитопов с наиболее широкой специфичностью по отношению к HLA II. Было выбрано 6 фрагментов длиной от 20 до 30 а.к.о., содержавших наибольшее количество Th эпитопов (Табл. 1).

Табл. 1. Фрагменты антигенов, выбранные для конструирования поли-Thэпитопного фрагмента.

LSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEE MAGA1 177-212 47 SFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSV MAGEA11 216-252 40 KASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGL MAGA3 153-189 41 VSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCF CTG1B 128-166 34 Кроме того, в состав поли-Th-эпитопной конструкции был включен универсальный хелперный эпитоп PADRE – Pan-DR Epitope (Ishioka et al., 1999). Для подтверждения экспрессии целевого полипептида в его состав был включен В-клеточный эпитоп белка Gag ВИЧ-1 (EPFRDYVDRFYKTLR) (Bazhan et al., 2004). Эпитопы были объединены с использованием мотива [KR][KR] – формирующего сайты расщепления лизосомных катепсинов B и L, принимающих участие в MHC-II-зависимом процессинге антигенов (Schneider et al., 2000; Zhu et al., 2005).

Согласно литературным данным добавление к целевому антигену сигнального пептида (обеспечивающего транспорт полиэпитопной конструкции в ЭПР) одновременно с C-концевым фрагментом LAMP- (перенаправляющего полиэпитоп в лизосомы для представления пептидов по пути MHC II) значительно увеличивает уровень ответа CD4+ Т-лимфоцитов (Bonehill et al., 2004; Bonini et al., 2001), поэтому на N-конец полиэпитопного полипептида был добавлен сигнальный пептид белка HER2 (P04626), а на его С-конец – 11 последних аминокислотных остатков белка LAMP-1 человека.

Подбор последовательности сигнального пептида был проведен с использованием сервера SignalP 3.0 (Bendtsen et al., 2004).

Последовательность антигена MEL-TCI-A0201 представлена на Рис. 9.

С помощью программы GeneDesigner (Villalobos et al., 2012) были спроектированы последовательности искусственных генов, кодирующих целевые полиэпитопные антигены, оптимизированные для экспрессии в клетках человека.

Синтезированные искусственные гены, кодирующие целевые полиэпитопные иммуногены, были клонированы в векторную плазмиду pcDNA3.1. Полученные рекомбинантные плазмиды pMEL-TCI-A0201 и pMEL-TCI – кандидаты ДНК-вакцины против меланомы – использовались для подтверждения экспрессии целевых генов с помощью ОТ-ПЦР, иммуноблоттинга и по окрашиванию клеток с помощью МАТ к Gag-эпитопу, экспрессируемому в составе полиэпитопных конструкций. Эти исследования были проведены в отделе биоинженерии ФБУН ГНЦ ВБ «ВЕКТОР» без участия автора.

MELAALCRWGLLLALLPPGAASAMDAIFGSLALMDKSLHVSILILSIIFIALGILTVILGVAIMPKAGLL

IADLKLMWITQCFLAHLLLRKYRVADAKHLYIFATCLSDGKYVLVTCLGLALLKFLWGPRALAAIGFLII

VLVMIAICILESLFRAADLVCMQLLFGIATLKVIWDVLSGIPDGSLAQDAPPLAILFFSSALLSIAYIFA

TCLGLAFLAMLKNTVALLIIVLAIIADAAKFVAAWTLKAAAKREEAAGIGILTVILGVLLLIGCWYCRRR

NGYRALMDKSKRLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEKRMSQNRLLILILSIIFIKGTY

ASEEVIWKRSFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVKRKASSSLQLVFGIELMEVDPIGH

LYIFATCLGLSYDGLKRVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFEPFRDYVDRFYKTL

RRKRSHAGYQTI

Рис. 9. Аллелеспецифический полиэпитопный антиген MEL-TCI-A0201. Серым цветом выделены спейсерные последовательности, обеспечивающие формирование необходимых сайтов протеасомного расщепления. Подчеркнутым полужирным курсивом – сайты расщепления эндосомными катепсинами. Полужирным курсивом с двойным подчеркиванием показан маркерный пептид из белка Gag ВИЧ-1, рамкой выделен эпитоп PADRE, с которого начинается поли-Th-эпитопный фрагмент. На N-конце полиэпитопа полужирным подчеркнутым шрифтом показан лидерный пептид белка ErbB2 (HER2), а белым полужирным подчеркнутым шрифтом на черном фоне – С-концевой фрагмент белка LAMP-1.

В дальнейшем в рамках работ по государственному контракту № 16.512.11.2186 сотрудниками лаборатории молекулярной иммунологии НИИКИ СО РАМН было проведено исследование иммуногенности ДНКвакцинной конструкции pMEL-TCI-A0201, кодирующей полиэпитопный иммуноген, содержащий цитотоксические эпитопы, рестриктированные HLA-A*0201, и ее способности индуцировать специфический лизис раковых клеток. Экспериментальные работы проводились в системе индукции Т-клеточного иммунного ответа ex vivo с использованием переферических мононуклеарных клеток крови условно-здоровых HLA-A*0201положительных доноров. Разрешение на проведение этих исследований было одобрено локальным этическим комитетом при ФГУН НИИКИ СО РАМН (протокола № 68 заседания этического комитета НИИКИ СОРАМН от февраля 2012 г.).

В качестве клеток-мишеней была использована культура клеток меланомы человека Mel Is, любезно предоставленная Российским онкологическим научным центром имени Н.Н. Блохина РАМН. В качестве отрицательного контроля использовалась культура мононуклеарных клеток (МНК) и совместная культура МНК и дендритных клеток (ДК), трансфецированных контрольной (векторной) плазмидой. В качестве положительного контроля была использована совместная культура МНК и полноразмерный меланомный антиген MART-1. Получение дендритных клеток и индукция их созревания проводились по методикам, описанным ранее (Хрипко и др., 2008). Трансфекция дендритных клеток ДНКвакцинными конструкциями проводилась с помощью системы магнитной трансфекции (MATra – Magnet-Assisted Transfection) по протоколу, рекомендованному производителем (Promokine, USA). Способность полиэпитопной конструкции индуцировать специфический Т-клеточный иммунный ответ изучали в реакции IFN-ELISpot (Рис. 10).

Рис. 10. (A) Количество спот-формирующих IFN-продуцирующих клеток (на клеток) в культуре мононуклеарных клеток периферической крови (МНК) условноздоровых доноров и в совместной культуре с аутологичными ДК (n = 21). (Б) Доля от максимального количества спот-формирующих IFN-продуцирующих клеток (для каждого из пациентов) в культуре мононуклеарных клеток периферической крови (МНК) условно-здоровых доноров и в совместной культуре с аутологичными ДК (n = 15). Жирной горизонтальной линией отмечено среднее значение.

PBMC (peripheral blood mononuclear cells) – контрольная культура МНК; DCC – совместная культура МНК и ДК, трансфецированных контрольной плазмидой; DCA – совместная культура МНК и ДК, трансфецированных плазмидой специфичной для HLA-A0201 (pMEL-TCI-A0201); DCM – совместная культура МНК и ДК, трансфецированных плазмидой, кодирующей полноразмерный белок MART-1;

PBMC.Lys, DCC.Lys, DCA.Lys и DCM.Lys – соответствующие культуры с лизатом клеток Mel Is Сравнение способности ДК, трансфецированных различными плазмидами, индуцировать Т-клеточный ответ (рис.10А) показало, что в присутствии лизата клеток меланомы (Mel Is) в совместных культурах МНК и ДК, трансфецированных плазмидами pMEL-TCI-A0201 (DCA.Lys) и pcDNA-mart1 (DCM.Lys – положительный контроль), образуется достоверно большее количество IFN-продуцирующих клеток, чем при культивировании МНК (PBMC.Lys) (p = 0.0004 и 0.0398) и ДК, трансфецированных контрольной плазмидой (DCC.Lys) (p = 0.0107 и p = 0.0864) в присутствии лизата. Уровень клеток, продуцирующих IFN в совместной культуре МНК и ДК, трансфецированных целевой плазмидой pMEL-TCI-A0201, и при стимуляции ДК, трансфецированных плазмидой pcDNA-mart1, не отличался (p = 0.599). При этом группы DCC, DCA и DCM статистически не отличаются между собой, но достоверно отличны от PBMC (p < 0.005).

Группы DCA.Lys и DCM.Lys (положительный контроль) отличаются от отрицательных контролей и от групп DCA и DCM (p < 0.028).

Статистический анализ проводился с использованием парного теста Уилкоксона с использованием FDR-коррекции.

На Рис. 10А видно, что целевая полиэпитопная конструкция и плазмида, кодирующая полноразмерный белок MART-1, обеспечивают наибольшую экспрессию IFN. Все экспериментальные группы, в которых проводилась стимуляция лизатом клеток меланомы, демонстрируют бимодальность распределения – то есть, по-видимому, клетки части пациентов не ответили на стимуляцию лизатом. Лишь у 15 пациентов из (71.4 %) число IFN-продуцирующих клеток в присутствии лизата превысило в 4 раза среднее число клеток, продуцирующих IFN, в отрицательной контрольной группе PBMC в отсутствие лизата.

На Рис. 10Б приведены результаты IFN-ELISpot для 15 пациентов, продемонстрировавших индукцию Т-клеточного ответа, – доля от максимального количества IFN-продуцирующих клеток, полученного для каждого из пациентов. Целевая полиэпитопная конструкция в наибольшей степени стимулирует экспрессию IFN. Однако и в данном случае отличия между группами DCA.Lys и DCM.Lys были статистически незначимы.

Таким образом, исследования, проведенные в системе индукции Т-клеточного иммунного ответа ex vivo, показали, что спроектированная с помощью разработанных моделей и алгоритмов полиэпитопная конструкция MEL-TCI-A0201 обладает способностью индуцировать Т-клеточный иммунный ответ против антигенов меланомы человека и не уступает по эффективности полноразмерному меланомному антигену MART-1.

ВЫВОДЫ

1. Разработаны новые статистические регрессионные модели, предсказывающие аффинность связывания нонамерных пептидов с аллельными вариантами молекул MHC I класса человека по аминокислотной последовательности пептидов.

2. Сравнение различных схем параметризации олигопептидов подтвердило, что модели, использующие кодирование пептидов в виде векторов свойств составляющих их аминокислотных остатков (PMBEC), обеспечивают лучшее качество предсказаний (по значению AUC – площади под кривой ошибок, характеризующей специфичность и чувствительность предсказаний), по сравнению с моделями, кодирующими олигопептиды виде разреженных векторов (p = 2.01 10-6).

3. Сравнительное тестирование полученных моделей с рядом других известных методов предсказания Т-клеточных эпитопов подтвердило их высокое качество. По медианному значению AUC (площади под кривой ошибок, характеризующей специфичность и чувствительность предсказаний) оригинальные модели (0.855) превзошли такие методы как SYFPEITHI (0.715), ProPred1 (0.810), SVMHC (0.710) и SVRMHC (0.710), а обновленные модели (0.917) не уступают лучшим современным методам предсказания Т-клеточных эпитопов NetMHC (0.908), SMMPMBEC (0.907). По значению IEDB_recommended (0.946), но превзошли его по значению коэффициента корреляции Пирсона (0.65 и 0.51, соответственно).

4. Разработан алгоритм рационального дизайна полиэптопных Т-клеточных антигенов, согласно которому оптимальная последовательность полиэпитопа определяется путем поиска наиболее длинного простого пути с наименьшим весом в направленном взвешенном графе, вершины которого соответствуют эпитопам, а ребра – допустимым паросочетаниям эпитопов. Вес каждого ребра определяется ранжирующей функцией, учитывающей количество предсказанных нецелевых эпитопов, образовавшихся на стыке эпитопов, распространенность аллельных вариантов молекул HLA, рестриктирующих нецелевые эпитопы, эффективность сайта протеасомного расщепления на Cконце первого из пары эпитопов и длину спейсерной последовательности.

5. На основе разработанных моделей и алгоритмов создано программное обеспечение для предсказания Т-клеточных эпитопов (TEpredict) и программа для рационального дизайна полиэпитопных антигенов (PolyCTLDesigner).

6. С использованием созданного программного обеспечения проведен дизайн иммунотерапевтической вакцины для лечения меланомы человека (MELTCI-A0201).

7. Исследования полученной ДНК-вакцины (pMEL-TCI-A0201), кодирующей целевой полиэпитопный антиген, в системе индукции Т-клеточного иммунного ответа ex vivo с использованием первичных культур иммунокомпетентных клеток человека подтвердили иммуногенность созданной конструкции (p < 0.05).

Публикации по теме диссертации Статьи 1. Антонец Д.В., Бакулина А.Ю., Портнягина О.Ю., Сидорова О.В., Новикова О.Д., Максютов А.З. Предсказание антигенно-активных районов OmpF-подобного порина Yersinia pseudotuberculosis. // Доклады Академии наук. – 2007. – Т.414. – С.544-546.

2. Антонец Д.В., Максютов А.З. TEpredict: программное обеспечение для предсказания Т-клеточных эпитопов. // Молекулярная биология. – 2010. – Т.44. – С.130-139.

3. Bazhan S.I., Karpenko L.I., Ilyicheva T.N., Belavin P.A., Seregin S.V., Danilyuk N.K., Antonets D.V., Ilyichev A.A. Rational design based synthetic polyepitope DNA vaccine for eliciting HIV-specific CD8+ T cell responses. // Mol. Immunol. – 2010. – V.47. – P.1507-1515.

4. Антонец Д.В. Обновление программного обеспечения TEpredict, предназначенного для предсказания Т-клеточных эпитопов. // Вестник НГУ. – 2012. – Т.10, вып. 5. – С.49-56.

5. Боробова Е.А., Антонец Д.В., Старостина Е.В., Смирнова О.Ю., Щербаков Д.Н., Волкова О.Ю., Орешкова С.Ф., Карпенко Л.И., Ильичев А.А., Бажан С.И.

Кандидаты ДНК-вакцины против меланомы: дизайн, конструирование и оценка экспрессии целевых генов в эукариотических клетках. // Вестник НГУ. – 2012. – Т.10, вып. 5. – С.23-30.

Патенты Антонец Д.В., Бажан С.И., Ильичев А.А., Карпенко Л.И., Боробова Е.А., Старостина Е.В., Смирнова О.Ю., Щербаков Д.Н., Орешкова С.Ф. Искусственный ген MEL-TCI-A0201, кодирующий полиэпитопный белок-иммуноген MEL-TCIA0201, рекомбинантная плазмидная ДНК рMEL-TCI-A0201, обеспечивающая экспрессию искусственного гена MEL-TCI-A0201 и искусственный белокиммуноген MEL-TCI-A0201, содержащий множественные CTL- и Th-эпитопы антигенов меланомы. // Заявка на патент РФ от 21.08.2012, регистрационный № 2012136088.

Тезисы конференций 1. Antonets D.V., Maksyutov A.Z. Prediction of T-cell epitopes within protein antigens:

theoretical analysis and software development. // 8th John Humphrey Advanced Summer Programme in Immunology. Immunology and viral infection, Moscow, September 10-14, 2007. – Abstr. Book, 2007. – P.5.

2. Антонец Д.В., Максютов А.З. Предсказание Т-клеточных эпитопов:

теоретический анализ и разработка программного обеспечения. // Вторая конференция по вопросам ВИЧ/СПИДа в Восточной Европе и Центральной Азии, Москва, 3-5 мая 2008 года: сб. тез. – М., 2008. – С.22.

3. Антонец Д.В., Максютов А.З. TEpredict: программа для предсказания Тклеточных эпитопов. // IV съезд Российского общества биохимиков и молекулярных биологов, Новосибирск, Россия, 11-15 мая 2008 года: сб. тез. – Новосибирск, 2008. – С.262.

4. Antonets D.V., Maksyutov A.Z. TEpredict: software for predicting T-cell epitopes. // The Sixth International Conference on Bioinformatics of Genome Regulation and Structure BGRS'2008, Novosibirsk, Russia, June 22-28, 2008. – Abstr. Book, 2008. – 5. Антонец Д.В., Максютов А.З. TEpredict: новые подходы к предсказанию Тклеточных эпитопов. // Объединенный иммунологический форум, СанктПетербург, 30 июня - 5 июля 2008 года. – Российский иммунологический журнал. – 2008. – Т.2. – С.118.

6. Antonets D.V., Maksyutov A.Z., Bazhan S.I. PolyCTLDesigner – the software for constructing polyepitope immunogens. // 4th Moscow Conference on Computational Molecular Biology. Moscow, July 20-23, 2009. – Abstr. Book, 2009. – P.19-20.

7. Антонец Д.В., Максютов А.З., Бажан С.И. PolyCTLDesigner: программное обеспечение для конструирования полиэпитопных вакцин. // Медицинская геномика и протеомика. Новосибирск, 9-13 сентября 2009 г.: сб. тез. – Новосибирск, 2009. – С.63.

8. Antonets D., Maksyutov A., Bazhan S. PolyCTLDesigner: the software for constructing highly efficient polyepitope immunogens. Application to HIV-1. // AIDS Vaccine 2009. Paris, France, October 19-22, 2009. – Retrovirology. – 2009. – V.6, suppl. 3. – P.284.

9. Антонец Д.В., Максютов А.З., Бажан С.И. PolyCTLDesigner. Создание новой полиэпитопной ВИЧ-1 вакцины in silico. // Третья конференция по вопросам ВИЧ/СПИДа в Восточной Европе и Центральной Азии, Москва, 28-30 октября 2009 г.: сб. тез. – М., 2009. – Т.2. – С.85.

10. Бажан С.И., Карпенко Л.И., Ильичева Т.Н., Белавин П.А., Серегин С.В., Антонец Д.В., Ильичев А.А., Ирвайн К., Гиббс Дж., Бенник Дж., Юделл Дж.

Рациональный дизайн вакцин для индукции ВИЧ-1 специфического ответа CD8+-Т-клеток. // Третья конференция по вопросам ВИЧ/СПИДа в Восточной Европе и Центральной Азии, Москва, 28-30 октября 2009 г.: сб. тез. – М., 2009.

11. Регузова А.Ю., Антонец Д.В., Максютов Р.А., Бажан С.И., Карпенко Л.И.

Конструирование и биологическое тестирование ДНК-вакцинных конструкций, кодирующих структурные варианты искусственного поли-CTL-эпитопного иммуногена ВИЧ-1. // Третья конференция по вопросам ВИЧ/СПИДа в Восточной Европе и Центральной Азии, Москва, 28-30 октября 2009 г.: сб. тез.

– М., 2009. – Т.2. – С.125.

12. Antonets D.V., Maksyutov A.Z., Bazhan S.I. PolyCTLDesigner: A program for designing cytotoxic T-cell polyepitope immunogens. // 35th FEBS Congress.

Gothenburg, Sweden, June 26 – July 1, 2010. – FEBS Journal. – 2010. – V.277. – 13. Antonets D.V., Maksyutov A.Z., Bazhan S.I. PolyCTLDesigner – software for constructing polyepitope cytotoxic T-cell immunogens. // 7th International Conference on Bioinformatics of Genome Regulation and Structure\Systems Biology (BGRS\SB-2010). Novosibirsk, Russia, June 20-27, 2010. – Abstr. Book, 2010. – 14. Bazhan S.I., Karpenko L.I., Ilyicheva T.N., Belavin P.A., Seregin S.V., Antonets D.V., Ilyichev A.A. Promising strategies for designing poly-CD8+ T cell-epitope DNA vaccine. // XVIII International Congress AIDS 2010, Vienna, Austria, July 18Abstr. Book, 2010. – V. 1, P. 290 (TUAA0103).

15. Bazhan S.I., Karpenko L.I., Ilyicheva T.N., Belavin P.A., Seregin S.V., Antonets D.V., Ilyichev A.A. Rational approaches for designing highly efficient DNA vaccines for eliciting HIV-specific CD8+ T cell responses. // WCVI’2010, Busan, South Korea, July 31- August 5, 2010. – Abstr. Book, 2010. – P. 185.

16. Antonets D. TEpredict – software for predicting T-cell epitopes: an update. // International Moscow Conference on Computational Molecular Biology (MCCMBMoscow, Russia, July 21-24, 2011. – Abstr. Book, 2011. – P.45-46.

17. Antonets D.V., Grudin D.S. TEpredict – software for predicting T-cell epitopes. An update. // The 8th International Conference on the Bioinformatics of Genome Regulation and Structure\Systems Biology (BGRS\SB-2012). Novosibirsk, Russia, June 25-29, 2012. – Abstr. Book, 2012. – P.38.

БЛАГОДАРНОСТИ

Автор выражает благодарность заведующему отделом биоинженерии ФБУН ГНЦ ВБ «Вектор» д.б.н. Ильичеву А.А., сотрудникам отдела биоинженерии д.б.н.

Карпенко Л.И., Боробовой Е.А., Старостиной Е.В., Регузовой А.Ю. за создание ДНК-вакцинных конструкций, несущих полиэпитопные Т-клеточные антигены.

Также благодарит заведующего лабораторией молекулярной иммунологии НИИКИ СО РАМН, д.м.н., профессора Сенникова С.В. и сотрудников лаборатории Лопатникову Ю.А., Курилина В.В. и Шевченко Ю.А. за исследование иммунологических характеристик ДНК-вакцины pMEL-TCI-A0201 в системе индукции Т-клеточного иммунного ответа ex vivo с использованием первичных культур иммунокомпетентных клеток человека. Автор благодарит сотрудников Российского онкологического научного центра имени Н.Н. Блохина РАМН за любезно предоставленные культуры клеток меланомы человека. Также признателен сотрудникам теоретического отдела ФБУН ГНЦ ВБ «Вектор» к.б.н.

Бакулиной А.Ю. и к.б.н. Максютову А.З. Особую благодарность автор выражает своему научному руководителю, заведующему теоретическим отделом ФБУН ГНЦ ВБ «Вектор», д.б.н. Бажану С.И. за всестороннюю поддержку при проведении исследований и написании диссертации.

Работа выполнена при финансовой поддержке Министерства образования и науки Российской Федерации (гос. контракт № 16.512.11.2186 и № 8289) и Российского фонда фундаментальных исследований (грант РФФИ № 12-04- мол_а).





Похожие работы:

«БОЛОТОВА АЛЕНА ИВАНОВНА РАБОЧАЯ ТЕТРАДЬ КАК СРЕДСТВО РАЗВИТИЯ ПОЗНАВАТЕЛЬНОЙ САМОСТОЯТЕЛЬНОСТИ ПРИ ОБУЧЕНИИ МАТЕМАТИКЕ МЛАДШИХ ШКОЛЬНИКОВ Специальность 13.00.02 – теория и методика обучения и воспитания (математика) АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата педагогических наук Москва – 2012 Работа выполнена на кафедре естественнонаучных дисциплин и методики их преподавания в начальной школе Государственного бюджетного образовательного учреждения высшего...»

«МАМОНТОВА ЕКАТЕРИНА ЮРЬЕВНА Девербативы в англоязычной и русскоязычной публицистике (сравнительный анализ) Специальность 10.02.20 – сравнительно-историческое, типологическое и сопоставительное языкознание АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата филологических наук Москва - 2012 Работа выполнена на кафедре иностранных языков факультета иностранных языков Международного славянского института Научный руководитель : доктор филологических наук, профессор...»

«НГУЕН НГОК ХОА ПЛОСКИЕ НЕСТАЦИОНАРНЫЕ КОНТАКТНЫЕ ЗАДАЧИ ДЛЯ УПРУГО-ПОРИСТЫХ СРЕД 01.02.04 – Механика деформируемого твердого тела АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата физико-математических наук Москва – 2012 Работа выполнена в Федеральном государственном бюджетном образовательном учреждении высшего профессионального образования Московский авиационный институт (национальный исследовательский университет) доктор физико-математических наук, профессор,...»

«СМИРНОВА Татьяна Юрьевна МОЛЕКУЛЯРНО-ГЕНЕТИЧЕСКИЕ И КЛЕТОЧНЫЕ ФАКТОРЫ, АССОЦИИРОВАННЫЕ С АКТИВНЫМ ДОЛГОЛЕТИЕМ 03.03.04. Клеточная биология, цитология, гистология АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата биологических наук Санкт-Петербург 2012 Работа выполнена в Федеральном государственном бюджетном учреждении науки Институт цитологии Российской академии наук кандидат биологических наук, доцент Научный руководитель : Спивак Ирина Михайловна Институт...»

«Красик Татьяна Яковлевна СОВЕРШЕНСТВОВАНИЕ ПРОЦЕССОВ РАЗРЫХЛЕНИЯ, ОЧИСТКИ И СМЕШИВАНИЯ ДЛЯ ПРОИЗВОДСТВА ХЛОПКОЛЬНЯНОЙ ПРЯЖИ Специальность 05.19.02 - Технология и первичная обработка текстильных материалов и сырья Автореферат диссертации на соискание ученой степени кандидата технических наук Иваново 2012 Работа выполнена в федеральном государственном бюджетном образовательном учреждении высшего профессионального образования Ивановская государственная текстильная академия...»

«СЛАБОСПИЦКАЯ Мария Вячеславовна УЧЕНИЧЕСКОЕ САМОУПРАВЛЕНИЕ КАК ФАКТОР СОЦИАЛИЗАЦИИ СТАРШЕКЛАССНИКОВ В ЛИЦЕЕ-ИНТЕРНАТЕ 13.00.01 – Общая педагогика, история педагогики и образования Автореферат диссертации на соискание ученой степени кандидата педагогических наук Оренбург - 2012 Работа выполнена в федеральном государственном бюджетном образовательном учреждении высшего профессионального образования Оренбургский государственный университет Научный руководитель – доктор...»

«Пустынникова Екатерина Васильевна ПРОЦЕССЫ ЭФФЕКТИВНОГО УПРАВЛЕНИЯ КОРПОРАТИВНЫМИ СТРУКТУРАМИ В ЭКОНОМИЧЕСКИХ КЛАСТЕРАХ (на примере Ульяновской области) 08.00.05 — Экономика и управление народным хозяйством (экономика, организация и управление предприятиями, отраслями, комплексами — промышленность) АВТОРЕФЕРАТ диссертации на соискание ученой степени доктора экономических наук Самара — 2012 Диссертационная работа выполнена на кафедре экономики и организации производства...»

«ВОЛХОНСКИЙ АЛЕКСЕЙ ОЛЕГОВИЧ РАЗРАБОТКА МУЛЬТИСЛОЙНЫХ НАНОСТРУКТУРНЫХ ПОКРЫТИЙ ДЛЯ РЕЖУЩЕГО ТВЕРДОСПЛАВНОГО ИНСТРУМЕНТА РАСШИРЕННОЙ ОБЛАСТИ ПРИМЕНЕНИЯ Специальность 05.16.06 – Порошковая металлургия и композиционные материалы Автореферат диссертации на соискание ученой степени кандидата технических наук Москва - 2012 Работа выполнена в Федеральном государственном автономном образовательном учреждении высшего профессионального образования Национальный исследовательский...»

«Беспалов Денис Евгеньевич Акмеологическое развитие профессионализма руководителя здравоохранения в системе непрерывного образования Специальность 19.00.13 – психология развития, акмеология (психологические наук и) АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата психологических наук Москва-2012 Работа выполнена на кафедре акмеологии и психологии профессиональной деятельности Федерального государственного бюджетного образовательного учреждения высшего...»

«Печетова Наталья Юрьевна СТИЛЕОБРАЗУЮЩИЕ ФАКТОРЫ РЕПРЕЗЕНТАЦИИ СОБЫТИЯ В РЕГИОНАЛЬНЫХ ГАЗЕТНО-ПУБЛИЦИСТИЧЕСКИХ ТЕКСТАХ (на материале газет Республики Саха) Специальность 10.02.01 – русский язык АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата филологических наук Барнаул – 2012 Диссертация выполнена на кафедре современного русского языка и речевой коммуникации ФГБОУ ВПО Алтайский государственный университет. Научный руководитель : доктор филологических наук,...»

«ШЕВЕ Злата Николаевна СОБСТВЕННОСТЬ КАК ПРЕДМЕТ ФИЛОСОФСКОГО ОСМЫСЛЕНИЯ Специальность 09.00.11 - социальная философия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата философских наук Уфа 2012 Диссертация выполнена на кафедре философии ФГБОУ ВПО Башкирский государственный университет. доктор философских наук, профессор Научный руководитель : Галимов Баязит Сабирьянович доктор философских наук, профессор Официальные оппоненты : Файзуллин Фаниль Саитович кандидат...»

«Молчанова Лилия Анатольевна ИННОВАЦИИ В ЖИВОПИСИ ВТОРОЙ ПОЛОВИНЫ ХХ в. (искусствоведческий анализ) Специальность 17.00.04 – изобразительное искусство, декоративно-прикладное искусство и архитектура АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата искусствоведения Барнаул – 2012 Работа выполнена на кафедре истории отечественного и зарубежного искусства ФГБОУ ВПО Алтайский государственный университет Научный руководитель : доктор искусствоведения, профессор...»

«ВАНАГ СЕРГЕЙ ВЛАДИМИРОВИЧ ПРОЦЕССЫ ОКИСЛЕНИЯ SO2 В SO3 С ИСПОЛЬЗОВАНИЕМ СТЕКЛОВОЛОКНИСТЫХ Pt-СОДЕРЖАЩИХ КАТАЛИЗАТОРОВ И ИХ АППАРАТУРНОЕ ОФОРМЛЕНИЕ 05.17.08 – Процессы и аппараты химических технологий АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата технических наук Томск – 2012 Работа выполнена в отделе технологии каталитических процессов Федерального государственного бюджетного учреждения науки Института катализа им. Г.К. Борескова Сибирского отделения...»

«КАРАВАНОВА АНАСТАСИЯ АНАТОЛЬЕВНА ВЛИЯНИЕ ВОДОРОДА НА СТРУКТУРУ И СВОЙСТВА ВЫСОКОУГЛЕРОДИСТЫХ СТАЛЕЙ И ГАЛЬВАНОЦИНКОВЫХ ПОКРЫТИЙ 05.16.01 Металловедение и термическая обработка металлов и сплавов Автореферат диссертации на соискание учёной степени кандидата технических наук Москва – 2012 Работа выполнена в ФГБОУ ВПО Тольяттинский государственный университет Научный руководитель : доктор физико-математических наук, профессор, Криштал Михаил Михайлович Официальные оппоненты :...»

«Ильницкая Елена Вячеславовна СТРУКТУРА И ФУНКЦИИ НОВЫХ БЕЛКОВ РЕСПИРАТОРНОГО ЭПИТЕЛИЯ rSec14p и rYm1olf 02.00.10 – Биоорганическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Москва - 2012 Работа выполнена в лаборатории белков гормональной регуляции Федерального государственного бюджетного учреждения науки Института биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова РАН доктор химических наук Научный руководитель :...»

«ПЕЙСАХОВИЧ АРТУР АВРАМОВИЧ ИССЛЕДОВАНИЕ И РАЗРАБОТКА ПРОЦЕССА ПАРОФАЗНОГО КРАШЕНИЯ ШВЕЙНЫХ НИТОК Специальность 05.19.02 Технология и первичная обработка текстильных материалов и сырья АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата технических наук Санкт-Петербург – 2012 Работа выполнена в Димитровградском инжененрно-технологическом институте (филиале) НИЯУ МИФИ Научный руководитель : Доктор технических наук, профессор ПАВУТНИЦКИЙ Вячеслав Васильевич Официальные...»

«Сакалла Мохамед Мохамед-Файез-Абдель-Халик Клинико-биохимическое исследование взаимодействия наночастиц меди с бактериальной флорой и ферментами ротовой жидкости у больных кариесом и изучение биологического действия наночастиц в экспериментальных исследованиях 14.03.10 – клиническая лабораторная диагностика Автореферат диссертации на соискание ученой степени кандидата медицинских наук Саратов – 2012 1 Работа выполнена в Государственном бюджетном образовательном учреждении...»

«Устинова Мария Николаевна ОКИСЛИТЕЛЬНАЯ ДЕСТРУКЦИЯ КАК СПОСОБ ИНАКТИВАЦИИ ЭКОПОЛЛЮТАНТОВ ФАРМАЦЕВТИЧЕСКОГО ПРОИСХОЖДЕНИЯ 03.02.08 – Экология АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Москва – 2012 Работа выполнена на кафедре общей химии Белгородского государственного национального исследовательского университета. Научный руководитель Доктор химических наук, профессор Лебедева Ольга Евгеньевна Официальные оппоненты : Лейкин Юрий Алексеевич,...»

«Рогалев Андрей Николаевич РАЗРАБОТКА И ИССЛЕДОВАНИЕ ВЫСОКОТЕМПЕРАТУРНЫХ ПАРОТУРБИННЫХ ТЕХНОЛОГИЙ ПРОИЗВОДСТВА ЭЛЕКТРОЭНЕРГИИ Специальность 05.14.01 – Энергетические системы и комплексы АВТОРЕФЕРАТ диссертации на соискание учёной степени кандидата технических наук МОСКВА 2012 2 Работа выполнена в Федеральном государственном бюджетном учреждении высшего профессионального образования Национальном исследовательском университете Московский энергетический институт(ФГБОУ ВПО НИУ...»

«DRACOCEPHALUM L.) 06.01.01 – 17.04.2012 60 90 1/16. 1,5.. 100. 12/04/11 Dracocephalum L.) ( 8. –.-., 2008. –. 36-39..., 1987;.., 2003)..., 2... Nepeta ( ) Dracocephalum ( )- //. - / 9. –.-., 2008. –. 49-50.,.. 3. Dracocephalum moldavica L.) // -, /.. 15. –.-., 2009. –. 56-60.. 5. - (Dracocephalum L.) (Dracocephalum L.) // Dracocephalum moldavica L.) // Dracocephalum L. // ; /...–.- –., 2007. – C. 3-7. ;.., 9...,..,. – //.. – /.,.. –.-.,...»








 
2014 www.av.disus.ru - «Бесплатная электронная библиотека - Авторефераты, Диссертации, Монографии, Программы»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.